| Edit |   |
| Antigenic Specificity | CCDC90A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC90A Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC90A. This antibody reacts with human. The CCDC90A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human CCDC90A. Peptide sequence ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV. |
| Other Names | C6orf79, coiled-coil domain containing 90A, coiled-coil domain-containing protein 90A, mitochondrial, FLJ20958 |
| Gene, Accession # | CCDC90A, Gene ID: 63933, Accession: NP_001026883, SwissProt: NP_001026883 |
| Catalog # | NBP1-91586 |
| Price | |
| Order / More Info | CCDC90A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |