| Edit |   |
| Antigenic Specificity | CCHCR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCHCR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCHCR1. This antibody reacts with human. The CCHCR1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CCHCR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEVHSQTWELERQKLLETMQHLQEDRDSLHATAELLQVRVQSLTHILALQEEELTRKVQPSDSLEPEFTRKCQSLLNRWREKVFALMVQLKAQELEHSDS |
| Other Names | C6orf18, CCHCR1 coiled-coil alpha-helical rod protein 1, HCR, SBP |
| Gene, Accession # | CCHCR1, Gene ID: 54535 |
| Catalog # | NBP2-58655 |
| Price | |
| Order / More Info | CCHCR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |