| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATG4B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATG4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATG4B. This antibody reacts with human. The ATG4B Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ATG4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL |
| Other Names | APG4 autophagy 4 homolog B, APG4 autophagy 4 homolog B (S. cerevisiae), APG4B, ATG4 autophagy related 4 homolog B (S. cerevisiae), AUTL1MGC1353, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B, cysteine protease ATG4B, DKFZp586D1822, EC 3.4.22, EC 3.4.22.-, hAPG4B, KIAA0943 |
| Gene, Accession # | ATG4B, Gene ID: 23192 |
| Catalog # | NBP2-57210 |
| Price | |
| Order / More Info | ATG4B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|