| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATG4D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATG4D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATG4D. This antibody reacts with human. The ATG4D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATG4D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV |
| Other Names | APG4 autophagy 4 homolog D, APG4 autophagy 4 homolog D (S. cerevisiae), APG4D, APG4-D, ATG4 autophagy related 4 homolog D (S. cerevisiae), AUTL4, AUT-like 4 cysteine endopeptidase, AUT-like 4, cysteine endopeptidase, AUT-like 4, cysteine endopeptidase (S. cerevisiae), Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D, cysteine protease ATG4D, cysteine protease involved in autophagy, EC 3.4.22, EC 3.4.22.- |
| Gene, Accession # | ATG4D, Gene ID: 84971 |
| Catalog # | NBP2-49525 |
| Price | |
| Order / More Info | ATG4D Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|