| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACSM5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACSM5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACSM5. This antibody reacts with human. The ACSM5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACSM5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYF |
|---|
| Other Names | acyl-CoA synthetase medium-chain family member 5, acyl-coenzyme A synthetase ACSM5, mitochondrial, EC 6.2.1, EC 6.2.1.2, FLJ20581, MACS3 |
|---|
| Gene, Accession # | ACSM5, Gene ID: 54988, Accession: Q6NUN0, SwissProt: Q6NUN0 |
|---|
| Catalog # | NBP1-91646 |
|---|
| Price | |
|---|
| Order / More Info | ACSM5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|