| 产品详情 |
| Edit |   |
| Antigenic Specificity | ACSS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACSS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACSS1. This antibody reacts with human, mouse. The ACSS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ACSS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQPGSYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETT |
| Other Names | ACAS2L, AceCS2, AceCS2L, Acetate--CoA ligase 2, Acetyl-CoA synthetase 2, acetyl-Coenzyme A synthetase 2 (AMP forming)-like, acetyl-coenzyme A synthetase 2-like, mitochondrial, acyl-CoA synthetase short-chain family member 1dJ568C11.3, EC 6.2.1, EC 6.2.1.1, FLJ45659, KIAA1846, MGC33843 |
| Gene, Accession # | ACSS1, Gene ID: 84532, Accession: Q9NUB1, SwissProt: Q9NUB1 |
| Catalog # | NBP2-30635 |
| Price | |
| Order / More Info | ACSS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25584894 |
| 产品资料 |
|
|