| Edit |   |
|---|
| Antigenic Specificity | ZNF710 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF710 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF710. This antibody reacts with human. The ZNF710 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNF710 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KVKFEKVEEEEQEVYEVSVPGDDKDAGPAEAPAEAASGGCDALVQSSAVKMIDLSAFSRKPRTLRHLPRTP |
|---|
| Other Names | DKFZp547K1113, FLJ00306, FLJ37393, MGC163413, zinc finger protein 710 |
|---|
| Gene, Accession # | ZNF710, Gene ID: 374655, Accession: Q8N1W2, SwissProt: Q8N1W2 |
|---|
| Catalog # | NBP2-38156 |
|---|
| Price | |
|---|
| Order / More Info | ZNF710 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|