| Edit |   |
|---|
| Antigenic Specificity | ZNF76 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF76 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF76. This antibody reacts with human. The ZNF76 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNF76 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HCKPYTCSTCGKTYRQTSTLAMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRI |
|---|
| Other Names | D6S229EZfp523, zinc finger protein 76, zinc finger protein 76 (expressed in testis), ZNF523Zinc finger protein 523 |
|---|
| Gene, Accession # | ZNF76, Gene ID: 7629 |
|---|
| Catalog # | NBP1-85324 |
|---|
| Price | |
|---|
| Order / More Info | ZNF76 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|