| Edit |   |
|---|
| Antigenic Specificity | ZNF79 |
|---|
| Clone | 3D12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF79 Antibody (3D12) from Novus Biologicals is a mouse monoclonal antibody to ZNF79. This antibody reacts with human. The ZNF79 Antibody (3D12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ZNF79 (NP_009066.1, 52 a.a. - 151 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRCLVSTPRDRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSF |
|---|
| Other Names | pT7, zinc finger protein 79, zinc finger protein 79 (pT7), ZNFpT7 |
|---|
| Gene, Accession # | ZNF79, Gene ID: 7633, Accession: NP_009066, SwissProt: NP_009066 |
|---|
| Catalog # | H00007633-M03 |
|---|
| Price | |
|---|
| Order / More Info | ZNF79 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|