| Edit |   |
|---|
| Antigenic Specificity | DDI1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DDI1 Antibody |
|---|
| Immunogen | The immunogen for Anti-DDI1 Antibody: synthetic peptide directed towards the middle region of human DDI1. Synthetic peptide located within the following region: KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE |
|---|
| Other Names | DNA-damage inducible 1 homolog 1 (S. cerevisiae) |
|---|
| Gene, Accession # | DDI1, Accession: NM_001001711 |
|---|
| Catalog # | TA336199 |
|---|
| Price | |
|---|
| Order / More Info | DDI1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|