| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Adiponutrin/PNPLA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Adiponutrin/PNPLA3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adiponutrin/PNPLA3. This antibody reacts with human. The Adiponutrin/PNPLA3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Adiponutrin/PNPLA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPEGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPS |
|---|
| Other Names | Acylglycerol O-acyltransferase, adiponutrin, ADPNdJ796I17.1, C22orf20, Calcium-independent phospholipase A2-epsilon, chromosome 22 open reading frame 20, EC 2.3.1.-, EC 2.7.7.56, EC 3.1.1.3, EC 4.2.3.4, FLJ22012, iPLA(2)epsilon, iPLA2-epsilon, patatin-like phospholipase domain containing 3, patatin-like phospholipase domain-containing protein 3 |
|---|
| Gene, Accession # | PNPLA3, Gene ID: 80339, Accession: Q9NST1, SwissProt: Q9NST1 |
|---|
| Catalog # | NBP2-34094 |
|---|
| Price | |
|---|
| Order / More Info | Adiponutrin/PNPLA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|