| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Adiponutrin/PNPLA3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Goat |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1.0 mg/ml |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Adiponutrin/PNPLA3 Antibody from Novus Biologicals is a goat polyclonal antibody to Adiponutrin/PNPLA3. This antibody reacts with mouse. The Adiponutrin/PNPLA3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity: VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104 |
|---|
| Immunogen | Synthetic peptide (CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD) corresponding to aa 73-104 mouse Adiponutrin 3. |
|---|
| Other Names | Acylglycerol O-acyltransferase, adiponutrin, ADPNdJ796I17.1, C22orf20, Calcium-independent phospholipase A2-epsilon, chromosome 22 open reading frame 20, EC 2.3.1.-, EC 2.7.7.56, EC 3.1.1.3, EC 4.2.3.4, FLJ22012, iPLA(2)epsilon, iPLA2-epsilon, patatin-like phospholipase domain containing 3, patatin-like phospholipase domain-containing protein 3 |
|---|
| Gene, Accession # | PNPLA3, Gene ID: 80339 |
|---|
| Catalog # | NBP1-30092 |
|---|
| Price | |
|---|
| Order / More Info | Adiponutrin/PNPLA3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|