| 产品详情 |
| Edit |   |
| Antigenic Specificity | ADPRHL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Immunohistochemistry verified by a customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADPRHL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADPRHL2. This antibody reacts with human, mouse, rat. The ADPRHL2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADPRHL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
| Other Names | [Protein ADP-ribosylarginine] hydrolase-like protein 2, ADP-ribosylhydrolase 3, ADP-ribosylhydrolase like 2, ARH3EC 3.2.1.143, FLJ20446, poly(ADP-ribose) glycohydrolase ARH3, protein ADP-ribosylarginine hydrolase-like protein 2 |
| Gene, Accession # | ADPRHL2, Gene ID: 54936 |
| Catalog # | NBP1-88835 |
| Price | |
| Order / More Info | ADPRHL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|