| Edit |   |
|---|
| Antigenic Specificity | ACPT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACPT Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACPT. This antibody reacts with human. The ACPT Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND. |
|---|
| Other Names | acid phosphatase, testicular, EC 3.1.3.2, testicular acid phosphatase |
|---|
| Gene, Accession # | ACPT, Gene ID: 93650, Accession: Q9BZG2, SwissProt: Q9BZG2 |
|---|
| Catalog # | NBP1-62440-20ul |
|---|
| Price | |
|---|
| Order / More Info | ACPT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|