| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Importin alpha 3/KPNA4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Importin alpha 3/KPNA4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Importin alpha 3/KPNA4. This antibody reacts with human. The Importin alpha 3/KPNA4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human Importin alpha 3/KPNA4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ |
|---|
| Other Names | importin alpha 3, Importin alpha Q1, importin subunit alpha-4, importin-alpha-Q1, IPOA3, karyopherin alpha 4 (importin alpha 3), MGC12217, MGC26703, Qip1, QIP1Karyopherin subunit alpha-4, SRP3 |
|---|
| Gene, Accession # | KPNA4, Gene ID: 3840, Accession: O00629, SwissProt: O00629 |
|---|
| Catalog # | NBP2-38541 |
|---|
| Price | |
|---|
| Order / More Info | Importin alpha 3/KPNA4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|