| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Importin alpha 5/KPNA1/SRP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Importin alpha 5/KPNA1/SRP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Importin alpha 5/KPNA1/SRP1. This antibody reacts with human. The Importin alpha 5/KPNA1/SRP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Importin alpha 5/KPNA1/SRP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEMAPGGVITSDMIEMIFSKSPEQQLSATQK |
|---|
| Other Names | importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta |
|---|
| Gene, Accession # | KPNA1, Gene ID: 3836 |
|---|
| Catalog # | NBP2-47418 |
|---|
| Price | |
|---|
| Order / More Info | Importin alpha 5/KPNA1/SRP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|