| Edit |   |
| Antigenic Specificity | Importin alpha 5/KPNA1/SRP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Importin alpha 5/KPNA1/SRP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Importin alpha 5/KPNA1/SRP1. This antibody reacts with human. The Importin alpha 5/KPNA1/SRP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA. |
| Other Names | importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta |
| Gene, Accession # | KPNA1, Gene ID: 3836, Accession: P52294, SwissProt: P52294 |
| Catalog # | NBP1-54603-20ul |
| Price | |
| Order / More Info | Importin alpha 5/KPNA1/SRP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |