| 产品详情 |
| Edit |   |
| Antigenic Specificity | ABP1/AOC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABP1/AOC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABP1/AOC1. This antibody reacts with human. The ABP1/AOC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABP1/AOC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA |
| Other Names | ABP, amiloride binding protein 1 (amine oxidase (copper-containing)), Amiloride-binding protein, amiloride-sensitive amine oxidase, amiloride-sensitive amine oxidase [copper-containing], AOC1DAOamiloride-binding protein-1, DAO1, Diamine oxidase, EC 1.4.3, EC 1.4.3.22, Histaminase, KAO, Kidney amine oxidase |
| Gene, Accession # | ABP1, Gene ID: 26 |
| Catalog # | NBP1-89068 |
| Price | |
| Order / More Info | ABP1/AOC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|