| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABP1/AOC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABP1/AOC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABP1/AOC1. This antibody reacts with human. The ABP1/AOC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ABP1(amiloride binding protein 1 (amine oxidase (copper-containing))) The peptide sequence was selected from the C terminal of ABP1 (NP_001082). Peptide sequence QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF. |
|---|
| Other Names | ABP, amiloride binding protein 1 (amine oxidase (copper-containing)), Amiloride-binding protein, amiloride-sensitive amine oxidase, amiloride-sensitive amine oxidase [copper-containing], AOC1DAOamiloride-binding protein-1, DAO1, Diamine oxidase, EC 1.4.3, EC 1.4.3.22, Histaminase, KAO, Kidney amine oxidase |
|---|
| Gene, Accession # | ABP1, Gene ID: 26, Accession: P19801, SwissProt: P19801 |
|---|
| Catalog # | NBP1-58006 |
|---|
| Price | |
|---|
| Order / More Info | ABP1/AOC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 15830186 |
|---|
| 产品资料 |
|
|