| Edit |   |
|---|
| Antigenic Specificity | ABRA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABRA Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABRA. This antibody reacts with human. The ABRA Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ABRAThe immunogen for this antibody is ABRA. Peptide sequence QWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK. |
|---|
| Other Names | actin-binding Rho activating protein, actin-binding Rho-activating protein, STARSStriated muscle activator of Rho-dependent signaling |
|---|
| Gene, Accession # | ABRA, Gene ID: 137735, Accession: NP_631905, SwissProt: NP_631905 |
|---|
| Catalog # | NBP1-79505-20ul |
|---|
| Price | |
|---|
| Order / More Info | ABRA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|