| Edit |   |
| Antigenic Specificity | ABRA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABRA Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABRA. This antibody reacts with mouse. The ABRA Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Abra. Peptide sequence KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR. |
| Other Names | actin-binding Rho activating protein, actin-binding Rho-activating protein, STARSStriated muscle activator of Rho-dependent signaling |
| Gene, Accession # | ABRA, Gene ID: 137735, Accession: NP_780665 |
| Catalog # | NBP1-79506 |
| Price | |
| Order / More Info | ABRA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |