| Edit |   |
| Antigenic Specificity | Progesterone R/NR3C3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Progesterone R/NR3C3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Progesterone R/NR3C3. This antibody reacts with human. The Progesterone R/NR3C3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Progesterone R/NR3C3/PGR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS |
| Other Names | NR3C3PRNuclear receptor subfamily 3 group C member 3, progesterone receptor |
| Gene, Accession # | PGR, Gene ID: 5241, Accession: P06401, SwissProt: P06401 |
| Catalog # | NBP1-87774 |
| Price | |
| Order / More Info | Progesterone R/NR3C3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23555992 |