| Edit |   |
|---|
| Antigenic Specificity | Cytochrome C Oxidase subunit 6c |
|---|
| Clone | S51 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytochrome C Oxidase subunit 6c Antibody (S51) from Novus Biologicals is a mouse monoclonal antibody to Cytochrome C Oxidase subunit 6c. This antibody reacts with human. The Cytochrome C Oxidase subunit 6c Antibody (S51) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | COX6C (AAH00187, 1 a.a. - 75 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK |
|---|
| Other Names | Cytochrome c oxidase polypeptide VIc, cytochrome c oxidase subunit 6C, cytochrome c oxidase subunit VIc, cytochrome c oxidase subunit VIc preprotein |
|---|
| Gene, Accession # | COX6C, Gene ID: 1345, Accession: AAH00187, SwissProt: AAH00187 |
|---|
| Catalog # | H00001345-M03 |
|---|
| Price | |
|---|
| Order / More Info | Cytochrome C Oxidase subunit 6c Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|