| Edit |   |
|---|
| Antigenic Specificity | RPUSD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine, rat, mouse, bovine, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-RPUSD3 Antibody |
|---|
| Immunogen | The immunogen for anti-RPUSD3 antibody: synthetic peptide directed towards the middle region of human RPUSD3. Synthetic peptide located within the following region: MVLQLCPVLGDHMYSARVGTVLGQRFLLPAENNKPQRQVLDEALLRRLHL |
|---|
| Other Names | RNA pseudouridylate synthase domain containing 3 |
|---|
| Gene, Accession # | RUSD3, Accession: NM_173659 |
|---|
| Catalog # | TA344022 |
|---|
| Price | |
|---|
| Order / More Info | RPUSD3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|