| Edit |   |
|---|
| Antigenic Specificity | MGRN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-MGRN1 Antibody |
|---|
| Immunogen | The immunogen for anti-MGRN1 antibody: synthetic peptide directed towards the middle region of human MGRN1. Synthetic peptide located within the following region: EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS |
|---|
| Other Names | RNF156, mahogunin ring finger 1, E3 ubiquitin protein ligase |
|---|
| Gene, Accession # | MGRN1, Accession: NM_015246 |
|---|
| Catalog # | TA329849 |
|---|
| Price | |
|---|
| Order / More Info | MGRN1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|