| Edit |   |
|---|
| Antigenic Specificity | CRKL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CRKL Antibody |
|---|
| Immunogen | The immunogen for anti-CRKL antibody: synthetic peptide directed towards the middle region of human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS |
|---|
| Other Names | v-crk avian sarcoma virus CT10 oncogene homolog-like |
|---|
| Gene, Accession # | CRKL, Accession: NM_005207 |
|---|
| Catalog # | TA330325 |
|---|
| Price | |
|---|
| Order / More Info | CRKL Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|