| Edit |   |
| Antigenic Specificity | SENP5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-SENP5 Antibody |
| Immunogen | The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5. Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR |
| Other Names | SUMO1/sentrin specific peptidase 5 |
| Gene, Accession # | SENP5, Accession: NM_152699 |
| Catalog # | TA329775 |
| Price | |
| Order / More Info | SENP5 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |