| Edit |   |
| Antigenic Specificity | UCHL5IP - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-UCHL5IP Antibody - middle region |
| Immunogen | The immunogen for anti-UCHL5IP antibody: synthetic peptide directed towards the middle region of human UCHL5IP. Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC |
| Other Names | UCHL5IP, UIP1, HAUS augmin-like complex, subunit 7 |
| Gene, Accession # | HAUS7, Accession: NM_207107 |
| Catalog # | TA344997 |
| Price | |
| Order / More Info | UCHL5IP - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |