| Edit |   |
|---|
| Antigenic Specificity | POLR3G |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-POLR3G Antibody |
|---|
| Immunogen | The immunogen for Anti-POLR3G Antibody is: synthetic peptide directed towards the middle region of Human POLR3G. Synthetic peptide located within the following region: SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN |
|---|
| Other Names | RPC32, RPC7, polymerase (RNA) III (DNA directed) polypeptide G (32kD) |
|---|
| Gene, Accession # | RPC7, Accession: NM_006467 |
|---|
| Catalog # | TA332037 |
|---|
| Price | |
|---|
| Order / More Info | POLR3G Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|