| Edit |   |
| Antigenic Specificity | ITGB1BP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | n/a |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-ITGB1BP3 antibody |
| Immunogen | The immunogen for anti-ITGB1BP3 antibody: synthetic peptide directed towards the middle region of human ITGB1BP3. Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY |
| Other Names | n/a |
| Gene, Accession # | NRK2, Accession: NM_170678 |
| Catalog # | TA329511 |
| Price | |
| Order / More Info | ITGB1BP3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |