| Edit |   |
| Antigenic Specificity | MRFAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, human, porcine, dog |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MRFAP1 Antibody |
| Immunogen | The immunogen for anti-MRFAP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MRFAP1. Synthetic peptide located within the following region: KTQVEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVEL |
| Other Names | PAM14, PGR1, Morf4 family associated protein 1 |
| Gene, Accession # | MOFA1, Accession: NM_033296 |
| Catalog # | TA337947 |
| Price | |
| Order / More Info | MRFAP1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |