| Edit |   |
| Antigenic Specificity | GCSAML |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-GCSAML Antibody |
| Immunogen | The immunogen for anti-GCSAML antibody is: synthetic peptide directed towards the N-terminal region of Human GCSAML. Synthetic peptide located within the following region: ENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSG |
| Other Names | C1orf150, germinal center-associated, signaling and motility-like |
| Gene, Accession # | GCSAML, Accession: NM_145278 |
| Catalog # | TA334785 |
| Price | |
| Order / More Info | GCSAML Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |