| Edit |   |
|---|
| Antigenic Specificity | HTR7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-HTR7 Antibody |
|---|
| Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
|---|
| Other Names | 5HT7, 5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled |
|---|
| Gene, Accession # | 5HT7R, Accession: NM_000872 |
|---|
| Catalog # | TA329999 |
|---|
| Price | |
|---|
| Order / More Info | HTR7 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|