| Edit |   |
|---|
| Antigenic Specificity | C14ORF131 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-C14ORF131 Antibody |
|---|
| Immunogen | The immunogen for Anti-C14ORF131 Antibody: synthetic peptide directed towards the middle region of human C14ORF131. Synthetic peptide located within the following region: KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHL |
|---|
| Other Names | C14orf131, zinc finger protein 839 |
|---|
| Gene, Accession # | ZN839, Accession: NM_018335 |
|---|
| Catalog # | TA331866 |
|---|
| Price | |
|---|
| Order / More Info | C14ORF131 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|