| Edit |   |
|---|
| Antigenic Specificity | SCAMP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 85%, rat 87%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human SCAMP4 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP |
|---|
| Other Names | secretory carrier membrane protein 4, FLJ33847 |
|---|
| Gene, Accession # | Gene ID: 113178, UniProt: Q969E2, ENSG00000227500 |
|---|
| Catalog # | HPA043284 |
|---|
| Price | |
|---|
| Order / More Info | SCAMP4 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|