| Edit |   |
|---|
| Antigenic Specificity | PCGF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 87%, rat 87%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human PCGF2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP |
|---|
| Other Names | polycomb group ring finger 2, MEL-18, RNF110, ZNF144 |
|---|
| Gene, Accession # | Gene ID: 7703, UniProt: P35227, ENSG00000277258 |
|---|
| Catalog # | HPA047732 |
|---|
| Price | |
|---|
| Order / More Info | PCGF2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|