| Edit |   |
|---|
| Antigenic Specificity | ARHGAP15 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | dog, guinea pig, horse, mouse, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ARHGAP15 Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-ARHGAP15 antibody: synthetic peptide directed towards the middle region of human ARHGAP15. Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ |
|---|
| Other Names | BM046, Rho GTPase activating protein 15 |
|---|
| Gene, Accession # | RHG15, Accession: NM_018460 |
|---|
| Catalog # | TA344855 |
|---|
| Price | |
|---|
| Order / More Info | ARHGAP15 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|