| Edit |   |
| Antigenic Specificity | SERGEF |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SERGEF Antibody |
| Immunogen | The immunogen for Anti-SERGEF Antibody is: synthetic peptide directed towards the C-terminal region of Human SERGEF. Synthetic peptide located within the following region: HPALVQDPKVTYLSPDAIEDTESQKAMDKERNWKERQSETSTQSQSDWSR |
| Other Names | DELGEF, Gnefr, secretion regulating guanine nucleotide exchange factor |
| Gene, Accession # | SRGEF, Accession: NM_012139 |
| Catalog # | TA331999 |
| Price | |
| Order / More Info | SERGEF Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |