| Edit |   |
|---|
| Antigenic Specificity | GPATCH2 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-GPATCH2 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-Gpatch2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gpatch2. Synthetic peptide located within the following region: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV |
|---|
| Other Names | CT110, GPATC2, PPP1R30, G patch domain containing 2 |
|---|
| Gene, Accession # | GPTC2, Accession: NM_018040 |
|---|
| Catalog # | TA344940 |
|---|
| Price | |
|---|
| Order / More Info | GPATCH2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|